Ml23 (P02672) Protein Card

General Information
Name Ml23 (named by ConoServer)
Alternative name(s) M23
Organism Conus miliaris
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Wild type
Protein precursor Ml23 precursor (605)
Notes this sequence was directly derived from the precursor: some post-translational modifications may be missing.

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Cysteine framework VI/VII
Pharmacological family

Sequence
CSPPGSYCFGPAACCSNFCSTMSDVCQENWSG
Sequence evidence nucleic acid level
Average Mass 3333.63
Monoisotopic Mass 3331.16
Isoelectric Point 4.50
Extinction Coefficient [280nm] 6990.00

References
Duda,T.F. Jr. (0) Positive selection and patterns of divergence of orthologous toxin genes among related venomous predatory gastropods
Duda,T.F. Jr. and Remigio,E.A. (2008) Variation and evolution of toxin gene expression patterns of six closely related venomous marine snails. Mol. Ecol. 17:3018-3032

Internal links
Protein Precursor Ml23 precursor (605)
Nucleic acids
Structure

External links
Ncbi ABG26375

Tools