MaIr34 (P02680) Protein Card

General Information
Name MaIr34
Alternative name(s) Mr057
Organism Conus marmoreus
Organism region Indo-Pacific
Organism diet molluscivorous
Protein Type Wild type
Protein precursor MaIr34 precursor (1119)
MaIr34 precursor (5449)
MaIr34 precursor (6188)
MaIr34 precursor (6255)
MaIr34 precursor (6256)
Notes

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Cysteine framework VI/VII
Pharmacological family

Sequence
ECLEADYYCVLPFVGNGMCCSGICVFVCIAQKY
Sequence evidence protein level
Average Mass 3636.27
Monoisotopic Mass 3633.53
Isoelectric Point 6.14
Extinction Coefficient [280nm] 4470.00

References
Luo,S., Zhangsun,D., Lin,Q., Xie,L., Wu,Y. and Zhu,X. (2006) Sequence diversity of O-superfamily conopetides from Conus marmoreus native to Hainan Peptides 27:3058-3068
Dutertre,S., Jin,A.H., Kaas,Q., Jones,A., Alewood,P.F. and Lewis,R.J. (2013) Deep venomics reveals the mechanism for expanded peptide diversity in cone snail venom. Mol. Cell Proteomics 12:312-329

Internal links
Protein Precursor MaIr34 precursor (1119)
MaIr34 precursor (5449)
MaIr34 precursor (6188)
MaIr34 precursor (6255)
MaIr34 precursor (6256)
Nucleic acids
Structure

External links
Ncbi AAZ83763

Tools