SO4 (P02708) Protein Card

General Information
Name SO4
Alternative name(s) Conotoxin-12
Organism Conus striatus (Striated cone)
Organism region Indo-Pacific
Organism diet piscivorous
Protein Type Wild type
Protein precursor SO4 precursor (865)
SO4 precursor (1061)
Notes this sequence was directly derived from the precursor: some post-translational modifications may be missing.

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Cysteine framework VI/VII
Pharmacological family

Sequence
ATDCIEAGNYCGPTVMKICCGFCSPYSKICMNYPKN
Sequence evidence nucleic acid level
Average Mass 3920.55
Monoisotopic Mass 3917.62
Isoelectric Point 9.32
Extinction Coefficient [280nm] 4470.00

References
Lu,B.S., Yu,F., Zhao,D., Huang,P.T. and Huang,C.F. (1999) Conopeptides from Conus striatus and Conus textile by cDNA cloning Peptides 20:1139-1144
Kauferstein,S., Melaun,C. and Mebs,D. (2005) Direct cDNA cloning of novel conopeptide precursors of the O-superfamily Peptides 26:361-367

Internal links
Protein Precursor SO4 precursor (865)
SO4 precursor (1061)
Nucleic acids
Structure

External links
Ncbi Q5K0D6, CAH64845, Q9XZK3, AAD31909

Tools