BeB42 (P02745) Protein Card

General Information
Name BeB42
Organism Conus betulinus
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Wild type
Protein precursor BeB42 precursor (1134)
Notes this sequence was directly derived from the precursor: some post-translational modifications may be missing.

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Cysteine framework VI/VII
Pharmacological family

Sequence
CNDPGGSCTRHYHCCQLYCNKQESVCLENEPAF
Sequence evidence nucleic acid level
Average Mass 3744.10
Monoisotopic Mass 3741.46
Isoelectric Point 5.81
Extinction Coefficient [280nm] 2980.00

References
Luo,S., Zhangsun,D., Zhang,B. and Lin,Q. (0) Hainan O-superfamily peptides
Zhangsun, D., Luo, S., Wu, Y., Zhu, X., Hu, Y. and Xie, L. (2006) Novel O-superfamily conotoxins identified by cDNA cloning from three vermivorous Conus species. Chem Biol Drug Des. 68:256-265

Internal links
Protein Precursor BeB42 precursor (1134)
Nucleic acids
Structure

External links
Ncbi AAZ83782

Tools