Ec15a precursor (P02759) Protein Card

General Information
Name Ec15a precursor
Organism Conus emaciatus
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily O2 superfamily
Pharmacological family

Sequence
MEKLTILILVATVLLAIQVLG
QGEGEKPPKEWVQQYAAKRL
WALMKGPR
QCTPKDAPCDDNNQCCSGLECKCFNMPDCQSGS
TCRV
Sequence region
[1-21]signal sequence
[50-86]mature peptideEc15a

References
Jiang, X., Pi, C. and Liu, Y. (0) A Novel Class of Conotoxin cDNAs with a Distinctive Cysteine Arrangement Unpublished

Internal links
Nucleic acids Conus emaciatus conotoxin ec15a mRNA, complete cds.
Structure

External links
UniProtKB/Swiss-Prot B0KZ79
Ncbi ABG01720, B0KZ79

Tools