Ml6.1 precursor (P02763) Protein Card

General Information
Name Ml6.1 precursor
Organism Conus miliaris
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Pharmacological family

Sequence
VLIIAVLFLTACQLTTA
VTSSRGKQKHRALRSTDKK
FAVTF
ICTPPGSDCNGHSDCCSNVCSTMSYVCQENWS
G
Sequence region
[1-17]signal sequence
[37-73]mature peptideMl6.1

References
Duda,T.F. Jr. and Remigio,E.A. (2008) Variation and evolution of toxin gene expression patterns of six closely related venomous marine snails. Mol. Ecol. 17:3018-3032

Internal links
Nucleic acids Conus miliaris isolate M18 four-loop conotoxin mRNA, partial cds.
Structure

External links
UniProtKB/Swiss-Prot A9P3V8
Ncbi ABO31216

Tools