Co6.5 precursor (P02770) Protein Card

General Information
Name Co6.5 precursor
Organism Conus coronatus
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Pharmacological family

Sequence
VLIIAVLLLTACQLTTA
ETSSRGKQKHRALRSTDKNSRMTK
R
CTPAGKACDATATCCVLFCNLVTNKCQVPRFP
Sequence region
[1-17]signal sequence
[43-74]mature peptideCo6.5

References
Duda,T.F. Jr. and Remigio,E.A. (2008) Variation and evolution of toxin gene expression patterns of six closely related venomous marine snails. Mol. Ecol. 17:3018-3032

Internal links
Nucleic acids Conus coronatus isolate C1 four-loop conotoxin mRNA, partial cds.
Structure

External links
UniProtKB/Swiss-Prot A9P3W5
Ncbi ABO31223

Tools