At6.3 precursor (P02772) Protein Card

General Information
Name At6.3 precursor
Organism Conus aristophanes
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Pharmacological family

Sequence
VLIIAVLFLTACQLTTA
ETSSRGEQKHRAPRSTDKNSRMTK
R
CTHAYEACDATTNCCYMTCNLPTRKCRGPLF
R
Sequence region
[1-17]signal sequence
[43-73]mature peptideAt6.3

References
Duda,T.F. Jr. and Remigio,E.A. (2008) Variation and evolution of toxin gene expression patterns of six closely related venomous marine snails. Mol. Ecol. 17:3018-3032

Internal links
Nucleic acids Conus aristophanes isolate M8 four-loop conotoxin mRNA, partialcds.
Structure

External links
UniProtKB/Swiss-Prot A9P3W7
Ncbi ABO31225

Tools