CalTx 12.2.1E (P02785) Protein Card

General Information
Name CalTx 12.2.1E
Organism Conus californicus
Organism region Eastern Pacific
Organism diet piscivorous
Protein Type Wild type

Classification
Conopeptide class conotoxin
Gene superfamily
Cysteine framework XII
Pharmacological family

Sequence
RGVCSTPEGSCVHNGCICQNAPCCHESGCNWANVCPGFLWD
KN
Sequence evidence Unknown
Average Mass 4590.09
Monoisotopic Mass 4586.80
Isoelectric Point 6.81
Extinction Coefficient [280nm] 11000.00

References
Gilly, W.F., Richmond, T.A., Duda, T.F., Elliger, C., Lebaric, Z., Schulz, J., Bingham, J.P. and Sweedler, J.V., (2011) Gilly, W.F., Richmond, T.A., Duda, T.F., Elliger, C., Lebaric, Z., Schulz, J., Bingham, J.P. and Sweedler, J.V., 2011. A diverse family of novel peptide toxins from an unusual cone snail, Conus californicus Journal of Experimental Biology 214:147-161

Internal links
Nucleic acids CalTx 12.2.1E precursor
Structure

External links
UniProtKB/Swiss-Prot A9UH01
Ncbi ABX79671, A9UH01

Tools