Ac8.1 precursor (P02822) Protein Card

General Information
Name Ac8.1 precursor
Organism Conus achatinus
Organism region Indo-Pacific
Organism diet piscivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily S superfamily
Pharmacological family

Sequence
LKMGAMFVLLLLFTLASS
QQEGDVQARKTSLKSDFYRALRQ
YDR
QCTLVNNCDRNGERACNGDCSCEGQICKCGYRVSPGKS
GCACTCRNA
K
Sequence region
[1-18]signal sequence
[45-91]mature peptideAc8.1

References
Liu,L., Wu,X., Yuan,D., Chi,C. and Wang,C. (2008) Identification of a novel S-superfamily conotoxin from vermivorous Conus caracteristicus. Toxicon 51:1331-1337

Internal links
Nucleic acids Conus achatinus S-superfamily conotoxin 8.1 mRNA, partial cds.
Structure

External links
UniProtKB/Swiss-Prot B2CI28
Ncbi B2CI28, ACA63847

Tools