Conkunitzin-S2 (P02858) Protein Card

General Information
Name Conkunitzin-S2
Organism Conus striatus (Striated cone)
Organism region Indo-Pacific
Organism diet piscivorous
Protein Type Wild type

Classification
Conopeptide class conotoxin
Gene superfamily
Cysteine framework XIV
Pharmacological family

Sequence
ARPKDRPSYCNLPADSGSGTKPEQRIYYNSAKKQCVTFTYN
GKGGNGNNFSRTNDCRQTCQYPVG
Sequence evidence Unknown
Average Mass 7207.90
Monoisotopic Mass 7203.34
Isoelectric Point 11.81
Extinction Coefficient [280nm] 7450.00

References
Korukottu,J., Bayrhuber,M., Montaville,P., Vijayan,V., Jung,Y.S., Becker,S. and Zweckstetter,M. (2007) Fast high-resolution protein structure determination by using unassigned NMR data. Angew. Chem. Int. Ed. Engl. 46:1176-1179

Internal links
Nucleic acids
Structure CONKUNITZIN-S2- CONE SNAIL NEUROTOXIN- DENOVO STRUCTURE

External links
Ncbi 2J6D_A

Tools