Tx6.1 (P03017) Protein Card

General Information
Name Tx6.1
Organism Conus textile (Cloth-of-gold cone)
Organism region Indo-Pacific
Organism diet molluscivorous
Protein Type Wild type
Protein precursor Tx6.1 precursor (3018)

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Cysteine framework VI/VII
Pharmacological family

Sequence
QVKPCRKEHQLCDLIFQNCCRGWYCVVLSCT
Sequence evidence nucleic acid level
Average Mass 3668.31
Monoisotopic Mass 3665.66
Isoelectric Point 10.31
Extinction Coefficient [280nm] 6990.00

References

Internal links
Protein Precursor Tx6.1 precursor (3018)
Nucleic acids
Structure

External links

Tools