Om6.5 (P03072) Protein Card

General Information
Name Om6.5
Organism Conus omaria
Organism region Indo-Pacific
Organism diet molluscivorous
Protein Type Wild type
Protein precursor Om6.5 precursor (3073)

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Cysteine framework VI/VII
Pharmacological family

Sequence
DDDCEPPGNFCGMIKIGPPCCSGWCFFACA
Sequence evidence nucleic acid level
Average Mass 3178.61
Monoisotopic Mass 3176.17
Isoelectric Point 4.03
Extinction Coefficient [280nm] 5500.00

References

Internal links
Protein Precursor Om6.5 precursor (3073)
Nucleic acids
Structure

External links

Tools