Au6.3 (P03074) Protein Card

General Information
Name Au6.3
Organism Conus aulicus
Organism region Indo-Pacific
Organism diet molluscivorous
Protein Type Wild type
Protein precursor Au6.3 precursor (3075)

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Cysteine framework VI/VII
Pharmacological family

Sequence
DYDCEPPGNFCGMIKIGPPCCSGWCFFACA
Sequence evidence nucleic acid level
Average Mass 3226.70
Monoisotopic Mass 3224.21
Isoelectric Point 4.21
Extinction Coefficient [280nm] 6990.00

References

Internal links
Protein Precursor Au6.3 precursor (3075)
Nucleic acids
Structure

External links

Tools