Au6.3 precursor (P03075) Protein Card

General Information
Name Au6.3 precursor
Organism Conus aulicus
Organism region Indo-Pacific
Organism diet molluscivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Pharmacological family

Sequence
MKLTCLMIVAVLFLTAWTFVTA
VPHSSNALENLYLKARHEM
ENPEASKLNTR
DYDCEPPGNFCGMIKIGPPCCSGWCFFACA
Sequence evidence nucleic acid level
Sequence region
[1-22]signal sequence
[53-82]mature peptideAu6.3

References

Internal links
Nucleic acids O-Superfamily Conotoxin Peptides.
Structure

External links

Tools