MVIB precursor (P03079) Protein Card

General Information
Name MVIB precursor
Organism Conus magus (Magus cone)
Organism region Indo-Pacific
Organism diet piscivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Pharmacological family

Sequence
MKLTCVMIVAVLFLTAWTFVTA
DDSRYGLKDLFPKERHEMK
NPEASKLNQR
EACYNAGSFCGIHPGLCCSEFCILWCITFVD
S
G
Sequence evidence nucleic acid level
Sequence region
[1-22]signal sequence
[52-83]mature peptideMVIB

References

Internal links
Nucleic acids O-Superfamily Conotoxin Peptides.
Structure

External links

Tools