M6.2 (P03080) Protein Card

General Information
Name M6.2
Organism Conus magus (Magus cone)
Organism region Indo-Pacific
Organism diet piscivorous
Protein Type Wild type
Protein precursor M6.2 precursor (3081)

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Cysteine framework VI/VII
Pharmacological family

Sequence
EACYNAGTFCGIKPGLCCSAICLSFVCISFDLIDVFSSP
Sequence evidence nucleic acid level
Average Mass 4089.75
Monoisotopic Mass 4086.80
Isoelectric Point 4.20
Extinction Coefficient [280nm] 1490.00

References

Internal links
Protein Precursor M6.2 precursor (3081)
Nucleic acids
Structure

External links

Tools