M6.2 precursor (P03081) Protein Card

General Information
Name M6.2 precursor
Organism Conus magus (Magus cone)
Organism region Indo-Pacific
Organism diet piscivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Pharmacological family

Sequence
MKLTCMMIVAVLFLTAWTFVTA
DDSRYGLKDLFPKERHEMK
NPEASKLNQR
EACYNAGTFCGIKPGLCCSAICLSFVCISFD
LIDVFSSP
Sequence evidence nucleic acid level
Sequence region
[1-22]signal sequence
[52-90]mature peptideM6.2

References

Internal links
Nucleic acids O-Superfamily Conotoxin Peptides.
Structure

External links

Tools