Gm6.5 (P03103) Protein Card

General Information
Name Gm6.5
Organism Conus gloriamaris
Organism region Indo-Pacific
Organism diet molluscivorous
Protein Type Wild type
Protein precursor Gm6.5 precursor (3104)

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Cysteine framework VI/VII
Pharmacological family

Sequence
DCQALWDYCPVPLLSSGDCCYGLICGPFVCIGW
Sequence evidence nucleic acid level
Average Mass 3592.16
Monoisotopic Mass 3589.50
Isoelectric Point 3.20
Extinction Coefficient [280nm] 13980.00

References

Internal links
Protein Precursor Gm6.5 precursor (3104)
Nucleic acids
Structure

External links

Tools