Gm6.5 precursor (P03104) Protein Card

General Information
Name Gm6.5 precursor
Organism Conus gloriamaris
Organism region Indo-Pacific
Organism diet molluscivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Pharmacological family

Sequence
MKLTCMMIVAVLFLTAWTLVMA
DDSNNGLANLFSKSRDEME
DPEASKLEKR
DCQALWDYCPVPLLSSGDCCYGLICGPFVCI
GW
Sequence evidence nucleic acid level
Sequence region
[1-22]signal sequence
[52-84]mature peptideGm6.5

References

Internal links
Nucleic acids O-Superfamily Conotoxin Peptides.
Structure

External links

Tools