Om6.6 (P03105) Protein Card

General Information
Name Om6.6
Organism Conus omaria
Organism region Indo-Pacific
Organism diet molluscivorous
Protein Type Wild type
Protein precursor Om6.6 precursor (3106)

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Cysteine framework VI/VII
Pharmacological family

Sequence
KTCQRRWDFCPGSLVGVITCCGGLICFLFFCV
Sequence evidence nucleic acid level
Average Mass 3567.29
Monoisotopic Mass 3564.64
Isoelectric Point 11.62
Extinction Coefficient [280nm] 5500.00

References

Internal links
Protein Precursor Om6.6 precursor (3106)
Nucleic acids
Structure

External links

Tools