Om6.6 precursor (P03106) Protein Card

General Information
Name Om6.6 precursor
Organism Conus omaria
Organism region Indo-Pacific
Organism diet molluscivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Pharmacological family

Sequence
MKLTCLMIVAVLFLTAWTFVMA
DDSNNGLANLFSKSRDEME
DTDPSKLENR
KTCQRRWDFCPGSLVGVITCCGGLICFLFFC
V
Sequence evidence nucleic acid level
Sequence region
[1-22]signal sequence
[52-83]mature peptideOm6.6

References

Internal links
Nucleic acids O-Superfamily Conotoxin Peptides.
Structure

External links

Tools