Da6.6 precursor (P03108) Protein Card

General Information
Name Da6.6 precursor
Organism Conus dalli
Organism region Eastern Pacific
Organism diet molluscivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Pharmacological family

Sequence
MKLTCVMIVAVLFLTAWTLVMA
DDSNNGLANLFSKLRDEME
DPEGSKLEKK
DCQEKWDYCPVPFLGSRYCCDGFICPSFFCA
Sequence evidence nucleic acid level
Sequence region
[1-22]signal sequence
[52-82]mature peptideDa6.6

References

Internal links
Nucleic acids O-Superfamily Conotoxin Peptides.
Structure

External links

Tools