Da6.7 (P03109) Protein Card

General Information
Name Da6.7
Organism Conus dalli
Organism region Eastern Pacific
Organism diet molluscivorous
Protein Type Wild type
Protein precursor Da6.7 precursor (3110)

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Cysteine framework VI/VII
Pharmacological family

Sequence
DCQGEWEFCIVPVLGFVYCCPWLICGPFVCVDI
Sequence evidence nucleic acid level
Average Mass 3748.43
Monoisotopic Mass 3745.63
Isoelectric Point 3.12
Extinction Coefficient [280nm] 12490.00

References

Internal links
Protein Precursor Da6.7 precursor (3110)
Nucleic acids
Structure

External links

Tools