Qc6.1 (P03115) Protein Card

General Information
Name Qc6.1
Organism Conus quercinus
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Wild type
Protein precursor Qc6.1 precursor (3116)

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Cysteine framework VI/VII
Pharmacological family

Sequence
KCAAAGEACVIPIIGNVFCCKGYCLFVCIS
Sequence evidence nucleic acid level
Average Mass 3090.75
Monoisotopic Mass 3088.42
Isoelectric Point 9.46
Extinction Coefficient [280nm] 1490.00

References

Internal links
Protein Precursor Qc6.1 precursor (3116)
Nucleic acids
Structure

External links

Tools