Cn6.1 (P03140) Protein Card

General Information
Name Cn6.1
Organism Conus consors
Organism region Indo-Pacific
Organism diet piscivorous
Protein Type Wild type
Protein precursor Cn6.1 precursor (3141)

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Cysteine framework VI/VII
Pharmacological family

Sequence
DGCYNAGTFCGIRPGLCCSEFCFLWCITFVDS
Sequence evidence nucleic acid level
Average Mass 3523.01
Monoisotopic Mass 3520.41
Isoelectric Point 4.20
Extinction Coefficient [280nm] 6990.00

References

Internal links
Protein Precursor Cn6.1 precursor (3141)
Nucleic acids
Structure

External links

Tools