Cn6.1 precursor (P03141) Protein Card

General Information
Name Cn6.1 precursor
Organism Conus consors
Organism region Indo-Pacific
Organism diet piscivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Pharmacological family

Sequence
MKLTCLMIVAVLFLTTWTFVTA
DDSRYGLKNLFPKARHEMK
NPEASKLNKR
DGCYNAGTFCGIRPGLCCSEFCFLWCITFVD
S
G
Sequence evidence nucleic acid level
Sequence region
[1-22]signal sequence
[52-83]mature peptideCn6.1

References

Internal links
Nucleic acids O-Superfamily Conotoxin Peptides.
Structure

External links

Tools