Vn6.6 (P03204) Protein Card

General Information
Name Vn6.6
Organism Conus ventricosus
Organism region Eastern Atlantic and Mediterranean
Organism diet vermivorous
Protein Type Wild type
Protein precursor Vn6.6 precursor (699)
Vn6.6 precursor (697)

Classification
Conopeptide class conotoxin
Gene superfamily O2 superfamily
Cysteine framework VI/VII
Pharmacological family

Sequence
GVDCVGLSSYCGPWNNPPCCSWYTCDYYCKF
Sequence evidence nucleic acid level
Average Mass 3525.92
Monoisotopic Mass 3523.32
Isoelectric Point 4.50
Extinction Coefficient [280nm] 16960.00

References
Conticello,S.G., Gilad,Y., Avidan,N., Ben-Asher,E., Levy,Z. and Fainzilber,M. (2001) Mechanisms for evolving hypervariability: the case of conopeptides Mol. Biol. Evol. 18:120-131

Internal links
Protein Precursor Vn6.6 precursor (699)
Vn6.6 precursor (697)
Nucleic acids
Structure

External links

Tools