Ts6.2 (P03206) Protein Card

General Information
Name Ts6.2
Organism Conus tessulatus
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Wild type
Protein precursor Ts6.2 precursor (700)

Classification
Conopeptide class conotoxin
Gene superfamily O2 superfamily
Cysteine framework VI/VII
Pharmacological family

Sequence
KTTAESWWEGECSGWSVYCTSDPECCSGECSSYYCELW
Sequence evidence nucleic acid level
Average Mass 4347.63
Monoisotopic Mass 4344.58
Isoelectric Point 3.75
Extinction Coefficient [280nm] 26470.00

References
Conticello,S.G., Gilad,Y., Avidan,N., Ben-Asher,E., Levy,Z. and Fainzilber,M. (2001) Mechanisms for evolving hypervariability: the case of conopeptides Mol. Biol. Evol. 18:120-131

Internal links
Protein Precursor Ts6.2 precursor (700)
Nucleic acids
Structure

External links

Tools