TxMEKL-0511/TxMEKL-0512 (P03210) Protein Card

General Information
Name TxMEKL-0511/TxMEKL-0512
Organism Conus textile (Cloth-of-gold cone)
Organism region Indo-Pacific
Organism diet molluscivorous
Protein Type Wild type
Protein precursor TxMEKL-0511/TxMEKL-0512 precursor (712)

Classification
Conopeptide class conotoxin
Gene superfamily O2 superfamily
Cysteine framework VI/VII
Pharmacological family

Sequence
WWRWGGCMAWFGLCSKDSECCSNSCDVTRCELMPFPPDW
Sequence evidence nucleic acid level
Average Mass 4585.20
Monoisotopic Mass 4581.81
Isoelectric Point 4.68
Extinction Coefficient [280nm] 27500.00

References
Conticello,S.G., Gilad,Y., Avidan,N., Ben-Asher,E., Levy,Z. and Fainzilber,M. (2001) Mechanisms for evolving hypervariability: the case of conopeptides Mol. Biol. Evol. 18:120-131

Internal links
Protein Precursor TxMEKL-0511/TxMEKL-0512 precursor (712)
Nucleic acids
Structure

External links

Tools