TxMEKL-053 (P03211) Protein Card

General Information
Name TxMEKL-053
Organism Conus textile (Cloth-of-gold cone)
Organism region Indo-Pacific
Organism diet molluscivorous
Protein Type Wild type
Protein precursor TxMEKL-053 precursor (713)

Classification
Conopeptide class conotoxin
Gene superfamily O2 superfamily
Cysteine framework VI/VII
Pharmacological family

Sequence
WWECGIWFSRCTKDSECCSNSCDQTYCELMPFPPDW
Sequence evidence nucleic acid level
Average Mass 4348.81
Monoisotopic Mass 4345.65
Isoelectric Point 4.20
Extinction Coefficient [280nm] 23490.00

References
Conticello,S.G., Gilad,Y., Avidan,N., Ben-Asher,E., Levy,Z. and Fainzilber,M. (2001) Mechanisms for evolving hypervariability: the case of conopeptides Mol. Biol. Evol. 18:120-131

Internal links
Protein Precursor TxMEKL-053 precursor (713)
Nucleic acids
Structure

External links

Tools