Ar6.15 (P03239) Protein Card

General Information
Name Ar6.15
Organism Conus arenatus
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Wild type
Protein precursor Ar6.15 precursor (744)

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Cysteine framework VI/VII
Pharmacological family

Sequence
QCTPVGGYCFDHHHCCSNHCIKSIGRCVAH
Sequence evidence nucleic acid level
Average Mass 3307.73
Monoisotopic Mass 3305.34
Isoelectric Point 9.43
Extinction Coefficient [280nm] 1490.00

References
Conticello,S.G., Gilad,Y., Avidan,N., Ben-Asher,E., Levy,Z. and Fainzilber,M. (2001) Mechanisms for evolving hypervariability: the case of conopeptides Mol. Biol. Evol. 18:120-131

Internal links
Protein Precursor Ar6.15 precursor (744)
Nucleic acids
Structure

External links

Tools