Ar6.28 (P03263) Protein Card

General Information
Name Ar6.28
Organism Conus arenatus
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Wild type
Protein precursor Ar6.28 precursor (785)

Classification
Conopeptide class conotoxin
Gene superfamily
Cysteine framework VI/VII
Pharmacological family

Sequence
VPEECEESCEEEEKTCCGLENGQPFCSRICW
Sequence evidence nucleic acid level
Average Mass 3561.86
Monoisotopic Mass 3559.35
Isoelectric Point 3.96
Extinction Coefficient [280nm] 5500.00

References
Conticello,S.G., Gilad,Y., Avidan,N., Ben-Asher,E., Levy,Z. and Fainzilber,M. (2001) Mechanisms for evolving hypervariability: the case of conopeptides Mol. Biol. Evol. 18:120-131

Internal links
Protein Precursor Ar6.28 precursor (785)
Nucleic acids
Structure

External links

Tools