Cal12.2f (P03269) Protein Card

General Information
Name Cal12.2f (named by ConoServer)
Alternative name(s) Cal12.2a,CalTx 12.2.1A
Organism Conus californicus
Organism region Eastern Pacific
Organism diet piscivorous
Protein Type Wild type
Protein precursor Cal12.2a precursor (815)

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Cysteine framework XII
Pharmacological family

Sequence
GVCSTPEGSCVHNGCICQNAPCCHPSGCNWANVCPGFLWDK
N
Sequence evidence nucleic acid level
Average Mass 4401.90
Monoisotopic Mass 4398.71
Isoelectric Point 6.81
Extinction Coefficient [280nm] 11000.00

References
Gilly, W.F., Richmond, T.A., Duda, T.F., Elliger, C., Lebaric, Z., Schulz, J., Bingham, J.P. and Sweedler, J.V., (2011) Gilly, W.F., Richmond, T.A., Duda, T.F., Elliger, C., Lebaric, Z., Schulz, J., Bingham, J.P. and Sweedler, J.V., 2011. A diverse family of novel peptide toxins from an unusual cone snail, Conus californicus Journal of Experimental Biology 214:147-161

Internal links
Protein Precursor Cal12.2a precursor (815)
Nucleic acids
Structure

External links
Ncbi P0DJC1

Tools