ABVIH (P03279) Protein Card

General Information
Name ABVIH
Organism Conus abbreviatus
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Wild type
Protein precursor ABVIH precursor (960)

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Cysteine framework VI/VII
Pharmacological family

Sequence
CTPAGDACDATTKCCIPFCNLATKKCQVPTFP
Sequence evidence nucleic acid level
Average Mass 3342.89
Monoisotopic Mass 3340.45
Isoelectric Point 10.54
Extinction Coefficient [280nm] NA

References
Duda,T.F. Jr. and Palumbi,S.R. (1999) Molecular genetics of ecological diversification: duplication and rapid evolution of toxin genes of the venomous gastropod Conus Proc. Natl. Acad. Sci. U.S.A. 96:6820-6823

Internal links
Protein Precursor ABVIH precursor (960)
Nucleic acids
Structure

External links

Tools