ABVIE (P03287) Protein Card

General Information
Name ABVIE
Organism Conus abbreviatus
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Wild type
Protein precursor ABVIE precursor (983)

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Cysteine framework VI/VII
Pharmacological family

Sequence
MTKHCTPPEVGCLFAYECCSKICWRPRCYPS
Sequence evidence nucleic acid level
Average Mass 3604.24
Monoisotopic Mass 3601.53
Isoelectric Point 9.86
Extinction Coefficient [280nm] 8480.00

References
Duda,T.F. Jr. and Palumbi,S.R. (1999) Molecular genetics of ecological diversification: duplication and rapid evolution of toxin genes of the venomous gastropod Conus Proc. Natl. Acad. Sci. U.S.A. 96:6820-6823

Internal links
Protein Precursor ABVIE precursor (983)
Nucleic acids
Structure

External links

Tools