TxMKLT1-031 (P03307) Protein Card

General Information
Name TxMKLT1-031
Organism Conus textile (Cloth-of-gold cone)
Organism region Indo-Pacific
Organism diet molluscivorous
Protein Type Wild type
Protein precursor TxMKLT1-031 precursor (1105)

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Cysteine framework VI/VII
Pharmacological family

Sequence
DCQEKWDFCPAPFFGSRYCCFGLFCTLFFCA
Sequence evidence nucleic acid level
Average Mass 3647.20
Monoisotopic Mass 3644.46
Isoelectric Point 4.80
Extinction Coefficient [280nm] 6990.00

References
Conticello,S.G., Gilad,Y., Avidan,N., Ben-Asher,E., Levy,Z. and Fainzilber,M. (2001) Mechanisms for evolving hypervariability: the case of conopeptides Mol. Biol. Evol. 18:120-131

Internal links
Protein Precursor TxMKLT1-031 precursor (1105)
Nucleic acids
Structure

External links

Tools