LtVIB (P03309) Protein Card

General Information
Name LtVIB
Alternative name(s) LeD41
Organism Conus litteratus
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Wild type
Protein precursor LtVIB precursor (1155)
LtVIB precursor (1110)

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Cysteine framework VI/VII
Pharmacological family

Sequence
ECSSPDESCTYHYNCCQLYCNKEENVCLENSPEV
Sequence evidence nucleic acid level
Average Mass 3928.19
Monoisotopic Mass 3925.46
Isoelectric Point 4.11
Extinction Coefficient [280nm] 4470.00

References
Pi,C., Liu,J., Peng,C., Liu,Y., Jiang,X., Zhao,Y., Tang,S., Wang,L., Dong,M., Chen,S. and Xu,A. (2006) Diversity and evolution of conotoxins based on gene expression profiling of Conus litteratus Genomics 88:809-819

Internal links
Protein Precursor LtVIB precursor (1155)
LtVIB precursor (1110)
Nucleic acids
Structure

External links

Tools