TeA53 (P03310) Protein Card

General Information
Name TeA53
Organism Conus textile (Cloth-of-gold cone)
Organism region Indo-Pacific
Organism diet molluscivorous
Protein Type Wild type
Protein precursor TeA53 precursor (1114)

Classification
Conopeptide class conotoxin
Gene superfamily O2 superfamily
Cysteine framework VI/VII
Pharmacological family

Sequence
WWRWGGCMLWFGRCTKDSECCSNSCDRTYCELARFPSDW
Sequence evidence nucleic acid level
Average Mass 4737.30
Monoisotopic Mass 4733.91
Isoelectric Point 7.44
Extinction Coefficient [280nm] 28990.00

References

Internal links
Protein Precursor TeA53 precursor (1114)
Nucleic acids
Structure

External links

Tools