LtVIA (P03334) Protein Card

General Information
Name LtVIA
Organism Conus litteratus
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Wild type
Protein precursor LtVIA precursor (1154)

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Cysteine framework VI/VII
Pharmacological family

Sequence
DAMQKSKGSGSCAYISEPCDILPCCPGLKCNEDFVPICL
Sequence evidence nucleic acid level
Average Mass 4130.77
Monoisotopic Mass 4127.79
Isoelectric Point 4.68
Extinction Coefficient [280nm] 1490.00

References
Pi,C., Liu,J., Peng,C., Liu,Y., Jiang,X., Zhao,Y., Tang,S., Wang,L., Dong,M., Chen,S. and Xu,A. (2006) Diversity and evolution of conotoxins based on gene expression profiling of Conus litteratus Genomics 88:809-819

Internal links
Protein Precursor LtVIA precursor (1154)
Nucleic acids
Structure

External links

Tools