Co6.1 (P03372) Protein Card

General Information
Name Co6.1
Organism Conus coronatus
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Wild type
Protein precursor Co6.1 precursor (2762)

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Cysteine framework VI/VII
Pharmacological family

Sequence
FAVIFTCTPPGSHCTGHSDCCSDFCSTMSDVCQ
Sequence evidence nucleic acid level
Average Mass 3481.84
Monoisotopic Mass 3479.28
Isoelectric Point 4.79
Extinction Coefficient [280nm] NA

References
Duda,T.F. Jr. and Remigio,E.A. (2008) Variation and evolution of toxin gene expression patterns of six closely related venomous marine snails. Mol. Ecol. 17:3018-3032

Internal links
Protein Precursor Co6.1 precursor (2762)
Nucleic acids
Structure

External links

Tools