Ml6.1 (P03373) Protein Card

General Information
Name Ml6.1
Organism Conus miliaris
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Wild type
Protein precursor Ml6.1 precursor (2763)

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Cysteine framework VI/VII
Pharmacological family

Sequence
FAVTFICTPPGSDCNGHSDCCSNVCSTMSYVCQENWS
Sequence evidence nucleic acid level
Average Mass 3988.35
Monoisotopic Mass 3985.49
Isoelectric Point 4.20
Extinction Coefficient [280nm] 6990.00

References
Duda,T.F. Jr. and Remigio,E.A. (2008) Variation and evolution of toxin gene expression patterns of six closely related venomous marine snails. Mol. Ecol. 17:3018-3032

Internal links
Protein Precursor Ml6.1 precursor (2763)
Nucleic acids
Structure

External links

Tools