At6.3 (P03382) Protein Card

General Information
Name At6.3
Organism Conus aristophanes
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Wild type
Protein precursor At6.3 precursor (2772)

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Cysteine framework VI/VII
Pharmacological family

Sequence
CTHAYEACDATTNCCYMTCNLPTRKCRGPLF
Sequence evidence nucleic acid level
Average Mass 3481.98
Monoisotopic Mass 3479.41
Isoelectric Point 9.71
Extinction Coefficient [280nm] 2980.00

References
Duda,T.F. Jr. and Remigio,E.A. (2008) Variation and evolution of toxin gene expression patterns of six closely related venomous marine snails. Mol. Ecol. 17:3018-3032

Internal links
Protein Precursor At6.3 precursor (2772)
Nucleic acids
Structure

External links

Tools