Sequence 401 from Patent EP1852440. (P03402) Protein Card

General Information
Name Sequence 401 from Patent EP1852440.
Organism Conus geographus (Geography cone)
Organism region Indo-Pacific
Organism diet piscivorous
Protein Type Patent

Classification
Conopeptide class conotoxin
Gene superfamily
Cysteine framework I
Pharmacological family

Sequence
SDGGNAAAKESDVIALTVWKCCTIPSCYEKKKIKACVF
Average Mass 4074.75
Monoisotopic Mass 4071.99
Isoelectric Point 10.05
Extinction Coefficient [280nm] 6990.00

References
Watkins, M., Hillyard, D.R., McIntosh, M.J., Jones, R.M. and Olivera, B.M. (2007) Alpha-conotoxin peptides Patent: EP 1852440-A 07-NOV-2007; University of Utah Research Foundation (US);

Internal links
Nucleic acids Sequence 401 from Patent EP1852440.
Structure

External links
Patent Lens EP
Ncbi CAR81647

Tools