Sequence 375 from Patent EP1852440. (P03413) Protein Card

General Information
Name Sequence 375 from Patent EP1852440.
Organism Conus purpurascens
Organism region Eastern Pacific
Organism diet piscivorous
Protein Type Patent

Classification
Conopeptide class conotoxin
Gene superfamily
Cysteine framework I
Pharmacological family

Sequence
SDGRDAEKTGFDTTIVPEDCCSDPSCWRLHSLACTGIVNR
Average Mass 4352.76
Monoisotopic Mass 4349.92
Isoelectric Point 4.89
Extinction Coefficient [280nm] 5500.00

References
Watkins, M., Hillyard, D.R., McIntosh, M.J., Jones, R.M. and Olivera, B.M. (2007) Alpha-conotoxin peptides Patent: EP 1852440-A 07-NOV-2007; University of Utah Research Foundation (US);

Internal links
Nucleic acids Alpha-conotoxin peptides
Sequence 375 from Patent EP1852440.
Structure

External links
Ncbi CAR81634

Tools