Sequence 295 from Patent EP1852440. (P03452) Protein Card

General Information
Name Sequence 295 from Patent EP1852440.
Organism Conus arenatus
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Patent

Classification
Conopeptide class conotoxin
Gene superfamily
Cysteine framework I
Pharmacological family

Sequence
SDGRNAARKAFGCCDLIPCLERYGNRCNEVH
Average Mass 3464.87
Monoisotopic Mass 3462.55
Isoelectric Point 9.47
Extinction Coefficient [280nm] 1490.00

References
Watkins, M., Hillyard, D.R., McIntosh, M.J., Jones, R.M. and Olivera, B.M. (2007) Alpha-conotoxin peptides Patent: EP 1852440-A 07-NOV-2007; University of Utah Research Foundation (US);

Internal links
Nucleic acids Sequence 295 from Patent EP1852440.
Structure

External links
Ncbi CAR81594

Tools