Sequence 287 from Patent EP1852440. (P03455) Protein Card

General Information
Name Sequence 287 from Patent EP1852440.
Organism Conus achatinus
Organism region Indo-Pacific
Organism diet piscivorous
Protein Type Patent

Classification
Conopeptide class conotoxin
Gene superfamily
Cysteine framework I
Pharmacological family

Sequence
SDGRNAAANDKASGMSALAVNECCTNPVCHVEHQELCARRR
Average Mass 4381.83
Monoisotopic Mass 4378.96
Isoelectric Point 8.15
Extinction Coefficient [280nm] NA

References
Watkins, M., Hillyard, D.R., McIntosh, M.J., Jones, R.M. and Olivera, B.M. (2007) Alpha-conotoxin peptides Patent: EP 1852440-A 07-NOV-2007; University of Utah Research Foundation (US);

Internal links
Nucleic acids Sequence 287 from Patent EP1852440.
Structure

External links
Ncbi CAR81590

Tools