Sequence 247 from Patent EP1852440. (P03475) Protein Card

General Information
Name Sequence 247 from Patent EP1852440.
Organism Conus regius
Organism region Eastern Pacific
Organism diet vermivorous
Protein Type Patent

Classification
Conopeptide class conotoxin
Gene superfamily
Cysteine framework I
Pharmacological family

Sequence
FDGRNAAADAKVINTVARIAWDICCSEPDCNHKCV
Average Mass 3803.27
Monoisotopic Mass 3800.73
Isoelectric Point 6.02
Extinction Coefficient [280nm] 5500.00

References
Watkins, M., Hillyard, D.R., McIntosh, M.J., Jones, R.M. and Olivera, B.M. (2007) Alpha-conotoxin peptides Patent: EP 1852440-A 07-NOV-2007; University of Utah Research Foundation (US);

Internal links
Nucleic acids Sequence 247 from Patent EP1852440.
Structure

External links
Ncbi CAR81570

Tools