Sequence 294 from patent US 6797808 (P00348) Protein Card

General Information
Name Sequence 294 from patent US 6797808
Organism Unknown
Protein Type Patent

Classification
Conopeptide class conotoxin
Gene superfamily
Pharmacological family

Sequence
SDGRNAAANAFDLIDLTARLNCCMIPPCWKKYGDRCSEVR
Average Mass 4475.13
Monoisotopic Mass 4472.11
Isoelectric Point 8.07
Extinction Coefficient [280nm] 7490.00

References
Watkins,M., Olivera,B.M., Hillyard,D.R., McIntosh,J.M. and Jones,R.M. (2002) Alpha-conotoxin peptides JP 2002534996-A 11 22-OCT-2002

Internal links
Nucleic acids Sequence 293 from patent US 6797808
Sequence 293 from Patent EP1852440.
Structure

External links
Patent Lens US6797808
Ncbi AAW06188, CAR81593

Tools