Conantokin-P precursor (P03531) Protein Card

General Information
Name Conantokin-P precursor
Organism Conus purpurascens
Organism region Eastern Pacific
Organism diet piscivorous
Protein Type Precursor

Classification
Conopeptide class conantokin
Gene superfamily B1 superfamily
Pharmacological family

Sequence
MQLYTYLYLLVPLVTFHLILSTGTLA
HGGTLTERRSTDTTA
LKPEPVLLQKSDARSTDDNDKDRLTQMKRILKKRGNKAR
GE
EEHSKYQECLREIRVNKVQQEC
Sequence region
[1-26]signal sequence
[27-80]pro region
[81-104]mature peptideConantokin-P

References
Gowd,K.H., Twede,V., Watkins,M., Krishnan,K.S., Teichert,R.W., Bulaj,G. and Olivera,B.M. (2008) Conantokin-P, an unusual conantokin with a long disulfide loop. Toxicon 52:203-213

Internal links
Nucleic acids
Structure

External links
UniProtKB/Swiss-Prot P0C8E3
Ncbi P0C8E3

Tools